Active Recombinant Human MSTN Protein
Cat.No. : | MSTN-211H |
Product Overview : | Recombinant Human MSTN Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 267-375 |
Description : | Myostatin, also known as GDF-8, is a conserved member of the TGF-beta superfamily. Myostatin is an essential regulator of skeletal muscle mass and cardiac muscle development and function. Myostatin is a secreted protein that negatively regulates skeletal muscle growth by determining muscle fiber number and size. Myostatin binds one of the two activin type II receptors (ACTRIIA or ACTRIIB) to activate SMAD signaling. Myostatin also activates MAPK signaling through TAK1-MKK6 and Ras pathways. Inhibition of myostatin increases muscle mass in a number of human disease animal models, such as muscular dystrophy. |
Bio-activity : | MPC-11 cell cytotoxicity, ≤50 ng/ml; ≥2.0 x 10^4 units/mg |
Molecular Mass : | Dimer, 12.4/24.8 kDa (109/218 aa) |
AA Sequence : | DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile 20 mM HCl at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | MSTN myostatin [ Homo sapiens (human) ] |
Official Symbol | MSTN |
Synonyms | MSTN; myostatin; GDF8, growth differentiation factor 8; growth/differentiation factor 8; GDF-8; growth differentiation factor 8; GDF8; MSLHP; |
Gene ID | 2660 |
mRNA Refseq | NM_005259 |
Protein Refseq | NP_005250 |
MIM | 601788 |
UniProt ID | O14793 |
◆ Recombinant Proteins | ||
MSTN-3422C | Recombinant Cat MSTN protein | +Inquiry |
Mstn-913R | Active Recombinant Rat Mstn | +Inquiry |
MSTN-0341H | Recombinant Human MSTN protein, His-tagged | +Inquiry |
MSTN-122H | Recombinant Human MSTN, GST-tagged | +Inquiry |
MSTN-2700R | Recombinant Rhesus Macaque MSTN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MSTN-2229MCL | Recombinant Mouse MSTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MSTN Products
Required fields are marked with *
My Review for All MSTN Products
Required fields are marked with *
0
Inquiry Basket