Active Recombinant Human MMP2 Protein (115-214, 393-447)

Cat.No. : MMP2-12H
Product Overview : Matrix Metalloproteinase-2 (MMP-2, Gelatinase A, Type IV collagenase) catalytic domain without fibronectin domains cloned from human cDNA, expressed in E. coli. The enzyme consists of the catalytic domain of human MMP-2 fibronectin deficient (residues 115-214 and 393-447 where the residue numbers are based on the unprocessed precursor, UniProtKB accession P08253).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 115-214, 393-447
Description : Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.
Bio-activity : > 40 U/μg. Activity described as U=100 pmol/min at 25 centigrade using a colorimetric assay with thiopeptide Ac-Pro-Leu-Gly-[2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OC2H5 as substrate.
Molecular Mass : 17.5 kDa
AA Sequence : M-RKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGA
Purity : > 95% by SDS-PAGE. The protein is observed, in denaturing conditions, as a single band migrating at a molecular weight between 14.4 and 18.4 kDa.
Applications : Enzyme kinetic studies, cleavage of target substrates and screening of inhibitors.
Storage : At -80 centigrade. After initial defrost, aliquot the product into individual tubes and refreeze at -80 centigrade. Avoid repeated freeze/thaw cycles.
Concentration : 0.15 mg/mL
Storage Buffer : Tris 20 mM pH 7.2, CaCl2 10 mM, ZnCl2 0.1 mM, NaCl 0.3 M, acetohydroxamic acid (AHA) 0.5 M, glycerol 10%, Brij-35 0.05%. The concentration is calculated by the analysis of the absorbance at 280 nm (ε280= 32430 M-1cm-1 calculated).
Shipping : On Dry Ice
Gene Name MMP2 matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase) [ Homo sapiens (human) ]
Official Symbol MMP2
Synonyms MMP2; matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); CLG4, CLG4A, matrix metalloproteinase 2 (gelatinase A, 72kD gelatinase, 72kD type IV collagenase) , matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); 72 kDa type IV collagenase; TBE 1; MMP-2; gelatinase A; 72 kDa gelatinase; collagenase type IV-A; neutrophil gelatinase; matrix metalloproteinase-2; matrix metalloproteinase-II; CLG4; MONA; CLG4A; TBE-1; MMP-II;
Gene ID 4313
mRNA Refseq NM_001127891
Protein Refseq NP_001121363
MIM 120360
UniProt ID P08253

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MMP2 Products

Required fields are marked with *

My Review for All MMP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon