Active Recombinant Human MIF Protein
Cat.No. : | MIF-12H |
Product Overview : | Recombinant Human MIF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 123 amino acids |
Description : | This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active measured by its ability to bind rhCD74 in a functional ELISA. |
Molecular Mass : | Approximately 13.5 kDa, a single non-glycosylated polypeptide chain containing 123 amino acids. |
AA Sequence : | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALE |
Endotoxin : | Less than 1 EU/mg of rHuMIF as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 or -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | MIF macrophage migration inhibitory factor [ Homo sapiens (human) ] |
Official Symbol | MIF |
Synonyms | MIF; macrophage migration inhibitory factor; macrophage migration inhibitory factor; L-dopachrome isomerase; L-dopachrome tautomerase; epididymis secretory sperm binding protein; macrophage migration inhibitory factor (glycosylation-inhibiting factor); phenylpyruvate tautomerase; EC 5.3.2.1; EC 5.3.3.12 |
Gene ID | 4282 |
mRNA Refseq | NM_002415 |
Protein Refseq | NP_002406 |
MIM | 153620 |
UniProt ID | P14174 |
◆ Recombinant Proteins | ||
MIF-033H | Recombinant Human MIF Protein | +Inquiry |
MIF-277H | Recombinant Human MIF | +Inquiry |
MIF-2593R | Recombinant Rhesus Macaque MIF Protein, His (Fc)-Avi-tagged | +Inquiry |
MIF-2444H | Recombinant Human MIF Protein, His-tagged | +Inquiry |
MIF-3339R | Recombinant Rat MIF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIF Products
Required fields are marked with *
My Review for All MIF Products
Required fields are marked with *
0
Inquiry Basket