Active Recombinant Human MIF Protein

• Cat.No.: MIF-12H
• Product Overview: Recombinant Human MIF Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 123 amino acids
• Description: This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active measured by its ability to bind rhCD74 in a functional ELISA.
• Molecular Mass: Approximately 13.5 kDa, a single non-glycosylated polypeptide chain containing 123 amino acids.
• AA Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALE
• Endotoxin: Less than 1 EU/mg of rHuMIF as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 or -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: MIF macrophage migration inhibitory factor [ Homo sapiens (human) ]
• Official Symbol: MIF
• Synonyms: MIF; macrophage migration inhibitory factor; macrophage migration inhibitory factor; L-dopachrome isomerase; L-dopachrome tautomerase; epididymis secretory sperm binding protein; macrophage migration inhibitory factor (glycosylation-inhibiting factor); phenylpyruvate tautomerase; EC 5.3.2.1; EC 5.3.3.12
• Gene ID: 4282
• mRNA Refseq: NM_002415
• Protein Refseq: NP_002406
• MIM: 153620
• UniProt ID: P14174