Active Recombinant Human MAPT Protein

Cat.No. : MAPT-516H
Product Overview : Active Human Recombinant Tau (K18), P301L mutant Protein (Pre-formed Fibrils) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.
Bio-activity : Thioflavin T emission curve shows increased fluorescence (correlated to tau protein fibrillation) when active tau PFFs are combined with active tau monomers.
Molecular Mass : ~15.1 kDa
AA Sequence : SRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVLGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE
Purity : >95%
Applications : WB, SDS-PAGE, In vivo assay, In vitro assay
Usage : Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only.
Storage : At -80 centigrade.
Storage Buffer : 10 mM HEPES, 100 mM NaCl pH 7.4
Gene Name MAPT microtubule associated protein tau [ Homo sapiens (human) ]
Official Symbol MAPT
Synonyms MAPT; microtubule associated protein tau; TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; FTDP-17; PPP1R103. microtubule-associated protein tau; G protein beta1/gamma2 subunit-interacting factor 1; PHF-tau; neurofibrillary tangle protein; paired helical filament-tau; protein phosphatase 1, regulatory subunit 103
Gene ID 4137
mRNA Refseq NM_016841
Protein Refseq NP_058525
MIM 157140
UniProt ID P10636

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MAPT Products

Required fields are marked with *

My Review for All MAPT Products

Required fields are marked with *

0

Inquiry Basket

cartIcon