Active Recombinant Human MAP1S Protein, GST-tagged

• Cat.No.: MAP1S-318H
• Product Overview: Human BPY2IP1 partial ORF ( NP_060644.4, 929 a.a. - 1026 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Bio-activity: 139 pmol/ug x min
• Molecular Mass: 36.52 kDa
• AA Sequence: SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MAP1S microtubule-associated protein 1S [ Homo sapiens ]
• Official Symbol: MAP1S
• Synonyms: MAP1S; microtubule-associated protein 1S; BPY2 interacting protein 1 , BPY2IP1, C19orf5, chromosome 19 open reading frame 5 , VCY2 interacting protein 1 , VCY2IP1; FLJ10669; MAP8; MAP-1S; BPY2 interacting protein 1; BPY2-interacting protein 1; VCY2 interacting protein 1; VCY2-interacting protein 1; microtubule-associated protein 8; variable charge Y chromosome 2-interacting protein 1; BPY2IP1; C19orf5; VCY2IP1; VCY2IP-1; MGC133087
• Gene ID: 55201
• mRNA Refseq: NM_018174
• Protein Refseq: NP_060644
• MIM: 607573
• UniProt ID: Q66K74