Active Recombinant Human LDHA Protein, His-tagged

• Cat.No.: LDHA-29849TH
• Product Overview: Recombinant human LDHA (1-332aa) protein with His tag was expressed in E.coli (Bioactivity Validated).

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-332 a.a.
• Description: LDHA, also known as L-lactate dehydrogenase A chain, is an enzyme that catalyzes the conversion of L-lactate and NAD+ to pyruvate and NADH in the final step of anaerobic glycolysis. This protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in LDHA have been linked to exertional myoglobinuria.
• Form: Liquid
• Bio-activity: Specific activity is > 300 units/mg, in which one unit will convert 1.0 umole of pyruvate to L-lactate and beta-NAD per minute at pH 7.5 at 37C.
• Molecular Mass: 38.8 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
• Purity: > 95% by SDS - PAGE
• Storage: Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL(determined by Bradford assay)
• Storage Buffer: 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl

Gene Information

• Gene Name: LDHA
• Official Symbol: LDHA lactate dehydrogenase A [ Homo sapiens (human) ]
• Synonyms: LDHA; lactate dehydrogenase A; LDHM; GSD11; PIG19; HEL-S-133P; L-lactate dehydrogenase A chain; LDH muscle subunit; LDH-A; LDH-M; cell proliferation-inducing gene 19 protein; epididymis secretory sperm binding protein Li 133P; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; EC 1.1.1.27
• Gene ID: 3939
• mRNA Refseq: NM_005566
• Protein Refseq: NP_005557
• MIM: 150000
• UniProt ID: P00338