Active Recombinant Human KITLG Protein (165 aa)

• Cat.No.: KITLG-057K
• Product Overview: Recombinant Human KITLG Protein without tag was expressed in E. coli.

Specification

• Description: C-kit ligand, the recently identified ligand for the kit tyrosine kinase receptor, is mapped to the mouse S1 locus. This pleiotropic cytokine, alternately known as stem cell factor (SCF), mast cell growth factor (MGF) and steel-factor (SLF), plays essential roles in gametogenesis, melanogenesis and early stages of hematopoiesis. In vitro and in vivo, SCF can stimulate the proliferation of mature, as well as the proliferation and maturation of immature, mast cells. On purified primitive human and mouse hematopoietic precursors, SCF acts in a synergistic manner with various growth factors, such as IL-1, IL-3, IL-6, IL-7, and Epo, to induce myeloid, erythroid and lymphoid lineage colony formation. The finding that SCF is also expressed in the nervous system suggests a possible role for SCF in the development of the nervous system.
• Source: E. coli
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as calculated by the dose-dependant stimulation of the proliferation of human TF-1 cells is less than 3 ng/mL, corresponding to a Specific Activity of ＞3.3 × 10^5 IU/mg.
• Molecular Mass: Approximately 18.4 kDa, a single non-glycosylated polypeptide chain containing 165 amino acids.
• Protein length: 165
• AA Sequence: MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
• Endotoxin: Less than 1 EU/mg of rHuSCF as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: KITLG KIT ligand [ Homo sapiens (human) ]
• Official Symbol: KITLG
• Synonyms: KITLG; KIT ligand; SF; MGF; SCF; SLF; DCUA; FPH2; FPHH; KL-1; Kitl; WS2F; SHEP7; DFNA69; kit ligandc-Kit ligandfamilial progressive hyperpigmentation 2mast cell growth factorsteel factorstem cell factorEC 3.2.1.31
• Gene ID: 4254
• mRNA Refseq: NM_000899
• Protein Refseq: NP_000890
• MIM: 184745
• UniProt ID: P21583