Active Recombinant Human KDR, His-tagged, Biotinylated

• Cat.No.: KDR-630H
• Product Overview: The recombinant human KDR/VEGFR2/CD309 extracellular or ecto-domain (ECD) is expressed as a 756 amino acid protein consisting of Ala20 - Glu764 region of KDR and a C-terminal His-tag. It contains 18 potential N-linked glycosylation sites.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: 20-764 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Binds VEGF and inhibits VEGF-dependent proliferation of human umbilical vein endothelial cells (HUVEC).
• Molecular Mass: Calculated molecular mass (kDa): 84.6; Estimated by SDS-PAGE under reducing condition (kDa): 110-120 suggesting that the protein is glycosylated.
• AA Sequence: ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVI GNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEK RFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKL VLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGITRSDQGLYTCAASSGLMTK KNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSE RDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEE CANEPSHAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRG ERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLN ATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVS CTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKT NLESTGHHHHHHHH
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >90% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: KDR kinase insert domain receptor (a type III receptor tyrosine kinase) [ Homo sapiens ]
• Official Symbol: KDR
• Synonyms: KDR; kinase insert domain receptor (a type III receptor tyrosine kinase); vascular endothelial growth factor receptor 2; CD309; FLK1; VEGFR; VEGFR2; soluble VEGFR2; fetal liver kinase 1; fetal liver kinase-1; protein-tyrosine kinase receptor Flk-1; tyrosine kinase growth factor receptor
• Gene ID: 3791
• mRNA Refseq: NM_002253
• Protein Refseq: NP_002244
• MIM: 191306
• UniProt ID: P35968
• Chromosome Location: 4q11-q12
• Pathway: Angiogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem
• Function: ATP binding; Hsp90 protein binding; growth factor binding; integrin binding; nucleotide binding; protein binding; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor-activated receptor activity