Active Recombinant Human IL6 Protein

• Cat.No.: IL6-252H
• Product Overview: Recombinant Human IL6 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Interleukin-6 (IL-6) is an interleukin that in humans is encoded by the IL-6 gene and acts as both a pro-inflammatory and anti-inflammatory cytokine. It is secreted by T cells and macrophages to stimulate immune response. Furthermore, It plays an essential role in the final differentiation of B-cells into Ig-secreting cells involved in lymphocyte and monocyte differentiation. It also induces myeloma and plasmacytoma growth and induces nerve cells differentiation acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. The human IL-6 is a single non-glycosylated polypeptide chain containing 183 amino acids and it signals through a cell-surface type I cytokine receptor complex consisting of the ligand-binding IL-6Rα chain (CD126), and the signal- transducing component gp130 (also called CD130). The human IL-6 shares about 40% a.a. sequence identity with mouse and rat IL-6 and it is equally active on mouse and rat cells.
• Form: Sterile Filtered White lyophil
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.1 ng/mL, corresponding to a specific activity of > 1.0×10^7 IU/mg. Assay #2: Fu
• Molecular Mass: Approximately 20.7 kDa
• AA Sequence: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Endotoxin: Less than 1.0 EU/μg of rHuIL-6 as determined by LAL method.
• Purity: > 96% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL.

Gene Information

• Gene Name: IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens (human) ]
• Official Symbol: IL6
• Synonyms: IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6
• Gene ID: 3569
• mRNA Refseq: NM_00600
• Protein Refseq: NP_00591
• MIM: 147620
• UniProt ID: P05231