Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
30-212aa |
Description : |
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2). |
Form : |
Liquid |
Bio-activity : |
Measured in a cell proliferation assay using TF-1 human erythroleukemic cell. The ED50 range ≤ 0.8 ng/mL. |
Molecular Mass : |
23.1 kDa (204aa) confirmed by MALDI-TOF |
AA Sequence : |
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
Purity : |
> 95% by SDS-PAGE |
Applications : |
SDS-PAGE, Bioactivity |
Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : |
0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : |
Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |