Active Recombinant Human IL6 Protein (185 aa)

• Cat.No.: IL6-351I
• Product Overview: Recombinant human Interleukin-6 (rhIL-6) produced in E. coli is a single non-glycosylated polypeptide chain containing 185 amino acids. A fully biologically active molecule, rhIL-6 has a molecular mass of 20.9 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 185
• Description: Interleukin-6 (IL-6, also known as IFN-β2) is a pleiotropic cytokine that plays important roles in acute phase reactions, inflammation, hematopoiesis, bone metabolism, and cancer progression. IL-6 is secreted by T cells and macrophages to stimulate immune response. IL-6 is responsible for stimulating acute phase protein synthesis, as well as the production of neutrophils in the bone marrow. It supports the growth of B cells and is antagonistic to regulatory T cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.1 ng/mL, measured by the dose-dependent stimulation of the proliferation of IL-6 dependent murine 7TD1 cells, corresponding to a specific activity of > 1 × 10^7 units/mg.
• Molecular Mass: 20.9 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant human Interleukin-6 (rhIL-6) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-6 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 1xPBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ]
• Official Symbol: IL6
• Synonyms: IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6
• Gene ID: 3569
• mRNA Refseq: NM_000600
• Protein Refseq: NP_000591
• MIM: 147620
• UniProt ID: P05231