Active Recombinant Human IL4 Protein
Cat.No. : | IL22-106H |
Product Overview : | Recombinant Human Interleukin-4 is produced by our E.coli expression system and the target gene encoding His25-Ser153 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | His25-Ser153 |
Description : | Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. IL-4 is produced by mast cells, T cells, and bone marrow stromal cells. IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergic response. |
Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
Bio-activity : | Measured by the dose-dependent stimulation of TF-1 cells. ED50 is less than 2 ng/ml. Specific Activity of 5.0 x 10^6 IU/mg. |
AA Sequence : | MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGA TAQQFHRHKQLIRFLKRL DRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | IL4 interleukin 4 [ Homo sapiens (human) ] |
Official Symbol | IL4 |
Synonyms | Interleukin-4; IL-4; B-Cell Stimulatory Factor 1; BSF-1; Binetrakin; Lymphocyte Stimulatory Factor 1; Pitrakinra; BSF1; BCGF1; BSF-1; BCGF-1 |
Gene ID | 3565 |
mRNA Refseq | NM_000589.4 |
Protein Refseq | NP_000580.1 |
MIM | 147780 |
UniProt ID | P05112 |
◆ Recombinant Proteins | ||
IL4-313H | Active Recombinant Human IL4, Fc-tagged | +Inquiry |
IL4-362H | Active Recombinant Human il4,HIgG1 Fc-tagged | +Inquiry |
IL4-203H | Recombinant Active Human IL4 Protein, His-tagged(C-ter) | +Inquiry |
IL4-1258S | Recombinant Sheep IL4 Protein, His-B2M/MYC-tagged | +Inquiry |
IL4-92H | Recombinant Human IL4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *
0
Inquiry Basket