Active Recombinant Human IL4 Protein (130 aa)
Cat.No. : | IL4-094I |
Product Overview : | Recombinant Human IL4 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 130 |
Description : | Interleukin-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of TF1 cells is less than 0.2 ng/mL, corresponding to a Specific Activity of >5 × 10^6 IU/mg. |
Molecular Mass : | Approximately 15 kDa, a single non-glycosylated polypeptide chain containing 130 amino acids. |
AA Sequence : | MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
Endotoxin : | Less than 1 EU/mg of rHuIL-4 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL4 interleukin 4 [ Homo sapiens ] |
Official Symbol | IL4 |
Synonyms | IL4; interleukin 4; interleukin-4; B cell growth factor 1; B_cell stimulatory factor 1; BCGF 1; BCGF1; BSF1; IL 4; lymphocyte stimulatory factor 1; MGC79402; binetrakin; pitrakinra; IL-4; BSF-1; BCGF-1; |
Gene ID | 3565 |
mRNA Refseq | NM_000589 |
Protein Refseq | NP_000580 |
MIM | 147780 |
UniProt ID | P05112 |
◆ Recombinant Proteins | ||
IL4-669E | Active Recombinant Equine IL4 | +Inquiry |
Il4-245I | Active Recombinant Rat Il4 Protein, His-tagged | +Inquiry |
IL4-249H | Active Recombinant Human IL4 Protein | +Inquiry |
IL4-3105H | Recombinant Human IL4 protein, His-SUMO-tagged | +Inquiry |
IL4-5334H | Recombinant Human Interleukin 4, HQ-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *
0
Inquiry Basket