Active Recombinant Human IL1B Protein (153 aa)

• Cat.No.: IL1B-366I
• Product Overview: Recombinant human Interleukin-1 beta (rhIL-1β) produced in E. coli is a single non-glycosylated polypeptide chain containing 153 amino acids. A fully biologically active molecule, rhIL-1β has a molecular mass of 17.3kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 153
• Description: Interleukin-1 beta (rhIL-1β) is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 1.0 pg/mL, measured by the dose-dependent stimulation of mouse D10S cells, corresponding to a specific activity of 1.0 × 10^9 IU/mg.
• Molecular Mass: 17.3 kDa, observed by reducing SDS-PAGE.
• AA Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human Interleukin-1 beta (rhIL-1β) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-1β should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL1B interleukin 1, beta [ Homo sapiens ]
• Official Symbol: IL1B
• Synonyms: IL1B; interleukin 1, beta; interleukin-1 beta; IL 1B; IL1 BETA; IL1F2; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta; IL-1; IL1-BETA
• Gene ID: 3553
• mRNA Refseq: NM_000576
• Protein Refseq: NP_000567
• MIM: 147720
• UniProt ID: P01584