Recombinant Human IL1B Protein

• Cat.No.: IL1B-69H
• Product Overview: Recombinant Human Interleukin-1 beta is produced by our E.coli expression system and the target gene encoding Ala117-Ser269 is expressed.

Specification

• Species: Human
• Source: E.coli
• Protein Length: Ala117-Ser269
• Description: IL1B belongs to the IL-1 family. Interleukin 1 (IL-1) is a family of polypeptide cytokines consisting of two agonists, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2) encoded by two distinct genes and perform identical biological functions. IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response. It is identified as endogenous pyrogens, and is reported to stimulate the release of prostaglandin and collagenase from synovial cells.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM PB,150mM NaCl, pH7.4.
• AA Sequence: MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEK NLYLSCVLKDDKPTLQ LESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQ FVSS
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: IL1B interleukin 1 beta [ Homo sapiens (human) ]
• Official Symbol: IL1B
• Synonyms: Interleukin-1 beta; Catabolin; IL1F2; IL1B; IL-1; IL1beta; IL1-BETA
• Gene ID: 3553
• mRNA Refseq: NM_000576.3
• Protein Refseq: NP_000567.1
• MIM: 147720
• UniProt ID: P01584