Recombinant Rat IL17A Protein

• Cat.No.: IL17A-141R
• Product Overview: Recombinant Rat IL17A Protein without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Description: Interleukin 17A (IL-17A), also known as CTLA-8, is a member of the IL-17 family of proteins. IL-17A is proinflammatory cytokine that is secreted by activated
• Bio-activity: No biological activity data is available at this time.
• AA Sequence: MAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution:
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium citrate, pH 3.0
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature

Gene Information

• Gene Name: Il17a interleukin 17A [ Rattus norvegicus (Norway rat) ]
• Official Symbol: IL17A
• Synonyms: IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); Il17; IL-17; CTLA-8; IL-17A
• Gene ID: 301289
• mRNA Refseq: NM_001106897
• Protein Refseq: NP_001100367
• UniProt ID: Q61453