Active Recombinant Human IL-17AF Heterodimer Protein

Cat.No. : IL17A-138H
Product Overview : Recombinant Human IL-17AF Heterodimer Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 17AF (IL-17AF) is a heterodimer that is composed of the interleukin 17A (IL-17A) and interleukin 17F (IL-17F) members of the IL-17 family of cytokines. IL-17AF is produced by T helper 17 cells (Th17) following interleukin 23 (IL-23) stimulation. IL-17AF signals through the IL-17RA/IL-17RC receptor complex and functions to regulate inflammatory responses. IL-17AF induces chemokine and airway neutrophilia production, similar in function to IL-17A and IL-17F homodimers. In regard to these functions, IL-17AF is less active than the IL-17A homodimer and shows greater activity than the IL-17F homodimer. Human and rat IL-17AF are active on mouse cells.
Bio-activity : Production of IL-6 from mouse 3T3 cells, ≤50 ng/mL; ≥2.0 x 10^4 units/mg
Molecular Mass : Dimer, 30.7 kDa (IL-17A=137; IL-17F=134; Total=271 aa)
AA Sequence : IL-17A: MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
IL-17F: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL17A interleukin 17A [ Homo sapiens (human) ]
Official Symbol IL17A
Synonyms IL17A; interleukin 17A; CTLA8, IL17, interleukin 17 (cytotoxic T lymphocyte associated serine esterase 8); interleukin-17A; cytotoxic T lymphocyte associated protein 8; IL 17; IL 17A; CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; cytotoxic T-lymphocyte-associated protein 8; cytotoxic T-lymphocyte-associated serine esterase 8; interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); IL17; CTLA8; IL-17; IL-17A;
Gene ID 3605
mRNA Refseq NM_002190
Protein Refseq NP_002181
MIM 603149
UniProt ID Q16552

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL17A Products

Required fields are marked with *

My Review for All IL17A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon