Active Recombinant Human IGFBP1 Protein

• Cat.No.: IGFBP1-143H
• Product Overview: Recombinant Human IGFBP1 was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
• Bio-activity: ED50 was determined by its ability to inhibit IGF-I induced proliferation of MCF-7 is less than or equal to 0.5 ug/mL in the presence of 6 ng/ml of human IGF-I.
• Molecular Mass: 25.4 kDa
• AA Sequence: MAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: IGFBP1 insulin-like growth factor binding protein 1 [ Homo sapiens ]
• Official Symbol: IGFBP1
• Synonyms: IGFBP1; insulin-like growth factor binding protein 1; IBP1; insulin-like growth factor-binding protein 1; AFBP; alpha pregnancy associated endometrial globulin; amniotic fluid binding protein; binding protein 25; binding protein 26; binding protein 28; growth hormone independent binding protein; hIGFBP 1; IGF binding protein 1; IGF BP25; placental protein 12; PP12; IBP-1; IGFBP-1; binding protein-25; binding protein-26; binding protein-28; IGF-binding protein 1; growth hormone independent-binding protein; alpha-pregnancy-associated endometrial globulin; IGF-BP25; hIGFBP-1
• Gene ID: 3484
• mRNA Refseq: NM_000596
• Protein Refseq: NP_000587
• MIM: 146730
• UniProt ID: P08833