Recombinant Rhesus macaque IGFBP1 Protein, His-tagged

Cat.No. : IGFBP1-300R
Product Overview : Recombinant Rhesus macaque IGFBP1 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rhesus macaque
Source : HEK293
Tag : His
Protein Length : 281
Description : This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients.
Form : Lyophilized
Molecular Mass : 27.2 kDa
AA Sequence : MGHRPPPPAQRASAPVCCPRLEMSEVPVARVWLVLLLLTVQVGVTASAPWQCAPCSAEKLALCPPVPASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQDSDASASNAEAAGSPESPESTEITEEELLDNFHLMAPSEEDHSTLWDAIGTYDSSKAVHVTNVKKWKEPCRIELYRVVESLTKAQETSGEDISKFYLPNCNKNGFYHSRQCETSLAGEERLCWCVYPWNGKRIPGSPEIRGDPNCQTYFNVQN
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name IGFBP1 insulin-like growth factor binding protein 1 [ Macaca mulatta (Rhesus monkey) ]
Official Symbol IGFBP1
Synonyms IGFBP1; insulin-like growth factor binding protein 1; insulin-like growth factor-binding protein 1;
Gene ID 696994
mRNA Refseq XM_001085935
Protein Refseq XP_001085935
UniProt ID A0A1D5QTL3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IGFBP1 Products

Required fields are marked with *

My Review for All IGFBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon