Recombinant Rhesus macaque IGFBP1 Protein, His-tagged

• Cat.No.: IGFBP1-300R
• Product Overview: Recombinant Rhesus macaque IGFBP1 protein with His tag was expressed in HEK293.

Specification

• Species: Rhesus macaque
• Source: HEK293
• Tag: His
• ProteinLength: 281
• Description: This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP N-terminal domain and a thyroglobulin type-I domain. The encoded protein, mainly expressed in the liver, circulates in the plasma and binds both insulin-like growth factors (IGFs) I and II, prolonging their half-lives and altering their interaction with cell surface receptors. This protein is important in cell migration and metabolism. Low levels of this protein may be associated with impaired glucose tolerance, vascular disease and hypertension in human patients.
• Form: Lyophilized
• Molecular Mass: 27.2 kDa
• AA Sequence: MGHRPPPPAQRASAPVCCPRLEMSEVPVARVWLVLLLLTVQVGVTASAPWQCAPCSAEKLALCPPVPASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQDSDASASNAEAAGSPESPESTEITEEELLDNFHLMAPSEEDHSTLWDAIGTYDSSKAVHVTNVKKWKEPCRIELYRVVESLTKAQETSGEDISKFYLPNCNKNGFYHSRQCETSLAGEERLCWCVYPWNGKRIPGSPEIRGDPNCQTYFNVQN
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: IGFBP1 insulin-like growth factor binding protein 1 [ Macaca mulatta (Rhesus monkey) ]
• Official Symbol: IGFBP1
• Synonyms: IGFBP1; insulin-like growth factor binding protein 1; insulin-like growth factor-binding protein 1
• Gene ID: 696994
• mRNA Refseq: XM_001085935
• Protein Refseq: XP_001085935
• UniProt ID: A0A1D5QTL3