Active Recombinant Human IFNA2A Protein (165 aa)

Cat.No. : IFNA2-382I
Product Overview : Recombinant Interferon-Alpha 2a (IFN-Alpha 2a), Human produced in E. coli is a single non-glycosylated polypeptide chain containing 165 amino acids. A fully biologically active molecule, rhIFN-Alpha has a molecular mass of 19.2kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 165
Description : Interferon-Alpha 2a (IFN-Alpha 2a), Human produced by leukocytes is a member of Interferon family. IFN-alpha is mainly involved in innate immune response against a broad range of viral infections. IFN-alpha 2 has three acid stable forms (a,b,c) signaling through IFNAR2. IFN-alpha 2a shares 99.4%, 98.8% aa sequence identity with IFN-alpha 2b and 2c respectively. IFN-alpha contains four highly conserved cysteine residues which form two disulfide bonds, one of which is necessary for biological activity.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.1 ng/mL, measured by a cytotoxicity assay using TF-1 Cells, corresponding to a specific activity of > 1.0 × 10^7 units/mg.
Molecular Mass : 19.2kDa, observed by reducing SDS-PAGE.
AA Sequence : CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant human Interferon-Alpha 2a (rhIFN-Alpha 2a) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIFN-Alpha 2a should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name IFNA2 interferon alpha 2 [ Homo sapiens (human) ]
Official Symbol IFNA2
Synonyms IFNA2; interferon alpha 2; IFNA; IFNA2B; leIF A; IFN-alphaA; IFN-alpha-2; interferon alpha-2alpha-2a interferoninterferon alpha 2ainterferon alpha 2binterferon alpha A
Gene ID 3440
mRNA Refseq NM_000605
Protein Refseq NP_000596
MIM 147562
UniProt ID P01563

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFNA2 Products

Required fields are marked with *

My Review for All IFNA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon