Recombinant Human IFNA2 protein(61-180 aa), C-His-tagged
Cat.No. : | IFNA2-2517H |
Product Overview : | Recombinant Human IFNA2 protein(P01563)(61-180 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 61-180 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | FPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNL |
Gene Name | IFNA2 interferon, alpha 2 [ Homo sapiens ] |
Official Symbol | IFNA2 |
Synonyms | IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765; |
Gene ID | 3440 |
mRNA Refseq | NM_000605 |
Protein Refseq | NP_000596 |
MIM | 147562 |
UniProt ID | P01563 |
◆ Recombinant Proteins | ||
IFNA2-1192R | Active Recombinant Rhesus IFNA2 protein | +Inquiry |
IFNA2-382I | Active Recombinant Human IFNA2A Protein (165 aa) | +Inquiry |
IFNA2-113H | Active Recombinant Human IFN-alpha 2a Protein | +Inquiry |
IFNA2-80M | Recombinant Mouse IFNA2 Protein | +Inquiry |
IFNA2-03H | Recombinant Human IFNA2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA2-1634MCL | Recombinant Mouse IFNA2 cell lysate | +Inquiry |
IFNA2-954CCL | Recombinant Cynomolgus IFNA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNA2 Products
Required fields are marked with *
My Review for All IFNA2 Products
Required fields are marked with *
0
Inquiry Basket