Active Recombinant Human HRG1-β1 Protein

• Cat.No.: HRG1-β-18H
• Product Overview: Recombinant human Heregulin1-Beta1 (HRG1-Beta 1) produced in E. coli is a single non-glycosylated polypeptide chain containing 66 amino acids. A fully biologically active molecule, rh HRG1-Beta1 has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• ProteinLength: 66 amino acids
• Description: Heregulin1-Beta 1 (HRG1-Beta 1) is one of the isoforms encoded by Neuregulin (NRG) genes. NRGs are synthesized as large transmembrane precursor proteins, and the NRG family has 4 members and 26 isoforms. These isoforms provide large diversities, including different tissue distribution, variable potencies, and different biological functions. HRG1-β1 belongs to Type I HRG1, and is expressed in neural tissue, respiratory epithelia, and heart. In vivo, HRG1 binds and activates both ErbB3 and ErbB4, the transmembrane receptor tyrosine kinase, and is involved in the proliferation, differentiation, and survival of cells. Aberrantly produced HRG1 could be used in the constitute activation of the ErbB receptors; therefore, the upregulation of HRG1 contributes to the development of tumors, including breast cancer.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 1 ng/mL, measured by a cell proliferation assay using MCF-7 cells, corresponding to a specific activity of > 1× 10^6 units/mg.
• Molecular Mass: 7.6 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant human Heregulin1-Beta1(HRG1-Beta1) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhHRG1-Beta1 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Official Symbol: HRG1-β
• Synonyms: Heregulin-β1; HRG1-β