Active Recombinant Human HBEGF Protein
Cat.No. : | HBEGF-269H |
Product Overview : | Recombinant Human HBEGF Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds the EGF receptor with higher affinity and is thus more mitogenic, probably due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.5 ng/mL, measured in a cell proliferation assay using 3T3 cells. |
Molecular Mass : | 12-14 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | HBEGF heparin-binding EGF-like growth factor [ Homo sapiens ] |
Official Symbol | HBEGF |
Synonyms | HBEGF; heparin-binding EGF-like growth factor; diphtheria toxin receptor (heparin binding epidermal growth factor like growth factor), DTR, DTS, HEGFL; proheparin-binding EGF-like growth factor; Diphtheria toxin receptor (heparin binding EGF like growth factor); heparin binding epidermal growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DTS; DTSF; HEGFL; |
Gene ID | 1839 |
mRNA Refseq | NM_001945 |
Protein Refseq | NP_001936 |
MIM | 126150 |
UniProt ID | Q99075 |
◆ Recombinant Proteins | ||
HBEGF-871H | Active Recombinant Human HBEGF | +Inquiry |
HBEGF-13682H | Recombinant Human HBEGF, GST-tagged | +Inquiry |
HBEGF-3004H | Recombinant Human HBEGF Protein (Val21-Thr160), N-His tagged | +Inquiry |
HBEGF-5724H | Recombinant Human HBEGF Protein (Leu20-Leu148), C-His tagged | +Inquiry |
HBEGF-4076M | Recombinant Mouse HBEGF Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBEGF-551HCL | Recombinant Human HBEGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HBEGF Products
Required fields are marked with *
My Review for All HBEGF Products
Required fields are marked with *
0
Inquiry Basket