Active Recombinant Human GH1, Animal Free
Cat.No. : | GH1-132H |
Product Overview : | Recombinant human GH is a protein composed of 22.9 kDa, 205 amino residues. Human recombinant protein expressed in Nicotiana benthamiana. Recombinant human Growth Hormone contains a 6-His-tag at the N-terminal end, is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. Animal free product. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | Non |
Protein Length : | 205 a.a. |
Description : | GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature. |
Form : | Lyophilized from a PBS 0.05M buffer at pH 7.5. |
Bio-activity : | The biological activity of human Growth Hormone is measured by cell proliferation using Nb2-11 cells. ED50 ≤ 0.04-0.1 ng/mL |
Molecular Mass : | Recombinant human GH is a protein composed of 22.9 kDa, 205 amino residues. |
AA Sequence : | HHHHHHFPTIPLSRPFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQ KSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYS KFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFAG |
Endotoxin : | < 0.04="" eu="" ug="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Applications : | Western blot, Immunogen |
Storage : | This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C and it is recommended to add a carrier protein (0.1% HSA or BSA). Repeated freezing and thawing is not recommended. |
Reconstitution : | Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Upon reconstitution, It can be stored in working aliquots at –20°C for future use. Optimal reconstitution please follow batch Quality Control sheet instructions. |
Gene Name | GH1 growth hormone 1 [ Homo sapiens ] |
Official Symbol | GH1 |
Synonyms | GH1; growth hormone 1; somatotropin; GH; GH N; GHN; hGH N; pituitary growth hormone; GH-N; hGH-N; IGHD1B; |
Gene ID | 2688 |
mRNA Refseq | NM_000515 |
Protein Refseq | NP_000506 |
MIM | 139250 |
UniProt ID | P01241 |
Chromosome Location | 17q22-q24 |
Pathway | Adipogenesis, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; |
Function | growth factor activity; growth hormone receptor binding; growth hormone receptor binding; hormone activity; metal ion binding; prolactin receptor binding; protein binding; |
◆ Recombinant Proteins | ||
GH1-950P | Recombinant Pig GH1 protein, His-tagged | +Inquiry |
Gh1-784R | Recombinant Rat Gh1 protein, His & T7-tagged | +Inquiry |
GH1-007H | Recombinant Human GH1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
GH1-132H | Active Recombinant Human GH1, Animal Free | +Inquiry |
GH1-277G | Active Recombinant Human GH1 Protein | +Inquiry |
◆ Native Proteins | ||
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
GH1-5354H | Native Human Growth Hormone 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GH1-5944HCL | Recombinant Human GH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GH1 Products
Required fields are marked with *
My Review for All GH1 Products
Required fields are marked with *
0
Inquiry Basket