Active Recombinant Human FLT3LG Protein, His tagged
Cat.No. : | FLT3LG-11H |
Product Overview : | Recombinant human FLT3LG (27-184aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Baculovirus |
Tag : | His |
Protein Length : | 27-184aa |
Description : | Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts. |
Tag : | His |
Form : | Liquid |
Molecular Mass : | 19 kDa (166 aa) |
AA Sequence : | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP |
Bio-Activity : | Measured in a cell proliferation assay using OCI-AML5 acute myeloid leukemia cells. The ED50 range ≤ 5 ng/mL. |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Reference : | 1. Klein O., et al. (2013) Eur. J. Immunol. 43(2):533-539. 2. Nakamori Y., et al. (2012) Br. J. Haematol. 157(6):674-686. |
Gene Name | FLT3LG fms related receptor tyrosine kinase 3 ligand [ Homo sapiens (human) ] |
Official Symbol | FLT3LG |
Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L |
Gene ID | 2323 |
mRNA Refseq | NM_001459 |
Protein Refseq | NP_001450 |
MIM | 600007 |
UniProt ID | P49771 |
◆ Recombinant Proteins | ||
FLT3LG-939H | Recombinant Human FLT3LG Protein, His-tagged | +Inquiry |
FLT3LG-489H | Recombinant Human FLT3LG Protein | +Inquiry |
FLT3LG-4374H | Active Recombinant Human FLT3LG Protein, His-tagged | +Inquiry |
FLT3LG-16H | Active Recombinant Human FLT3LG Protein, Animal Free | +Inquiry |
FLT3LG-11H | Active Recombinant Human FLT3LG Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *
0
Inquiry Basket