Active Recombinant Human FLT3LG Protein, His tagged

• Cat.No.: FLT3LG-11H
• Product Overview: Recombinant human FLT3LG (27-184aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Baculovirus
• Tag: His
• Protein Length: 27-184aa
• Description: Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts.
• Tag: His
• Form: Liquid
• Molecular Mass: 19 kDa (166 aa)
• AA Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP
• Bio-Activity: Measured in a cell proliferation assay using OCI-AML5 acute myeloid leukemia cells. The ED50 range ≤ 5 ng/mL.
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Reference: 1. Klein O., et al. (2013) Eur. J. Immunol. 43(2):533-539.
  2. Nakamori Y., et al. (2012) Br. J. Haematol. 157(6):674-686.

Gene Information

• Gene Name: FLT3LG fms related receptor tyrosine kinase 3 ligand [ Homo sapiens (human) ]
• Official Symbol: FLT3LG
• Synonyms: FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L
• Gene ID: 2323
• mRNA Refseq: NM_001459
• Protein Refseq: NP_001450
• MIM: 600007
• UniProt ID: P49771