Active Recombinant Human FGFR2, His-tagged, Biotinylated

Source :	Human cells
Species :	Human
Tag :	His
Form :	Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule)
Bio-activity :	Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.
Molecular Mass :	Calculated molecular mass (kDa): 40.9; Estimated by SDS-PAGE under reducing condition (kDa): ~65
AA Sequence :	RPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIK GATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAV PAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHT YHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGV NTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLESTGHHHHHHHH
Endotoxin :	<0.1 eu per 1 μg of purified recombinant protein determined by the
Purity :	>95% judged by SDS-PAGE under reducing condition
Storage :	The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Protein length :	22-377 a.a.

Gene Name	FGFR2 fibroblast growth factor receptor 2 [ Homo sapiens ]
Official Symbol	FGFR2
Synonyms	FGFR2; fibroblast growth factor receptor 2; bacteria expressed kinase , BEK, CFD1, craniofacial dysostosis 1 , Jackson Weiss syndrome , JWS, keratinocyte growth factor receptor , KGFR; CD332; CEK3; Crouzon syndrome; ECT1; K SAM; Pfeiffer syndrome; TK14; TK25; FGFR-2; FGF receptor; soluble FGFR4 variant 4; bacteria-expressed kinase; hydroxyaryl-protein kinase; keratinocyte growth factor receptor; BEK fibroblast growth factor receptor; protein tyrosine kinase, receptor like 14; BEK; JWS; CFD1; KGFR; BFR-1; K-SAM; FLJ98662;
Gene ID	2263
mRNA Refseq	NM_000141
Protein Refseq	NP_000132
MIM	176943
UniProt ID	P21802
Chromosome Location	10q25.3-q26
Pathway	Angiogenesis, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem;
Function	ATP binding; fibroblast growth factor binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity;

COA

Cat.No. :	FGFR2-607H
Product Overview :	The recombinant human FGFR2 ECD protein is expressed as a 367 amino acid protein consisting of Arg22 - Glu377 region of FGFR2 (Uniprot accession #P21802 - isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 8 potential N-linked glycosylation sites.