Active Recombinant Human FGF9 Protein (207 aa)

• Cat.No.: FGF9-119F
• Product Overview: Recombinant Human FGF9 Protein without tag was expressed in E. coli.

Specification

• Description: Fibroblast growth factor 9 (FGF9) belongs to the large FGF family which has at least 23 members. All FGF family members are heparin binding growth factors with a core 120 amino acid (aa) FGF domain that allows for a common tertiary structure. FGF-9 targets glial cells, astrocytes cells and other cells that express the FGFR 1c, 2c, 3b, 3c, and 4.
• Source: E. coli
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is ≤0.5 ng/mL, corresponding to a specific activity of ≥ 2 × 10^6 units/mg.
• Molecular Mass: Approximately 23.4 kDa, a single non-glycosylated polypeptide chain containing 207 amino acids.
• Protein length: 207
• AA Sequence: APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Endotoxin: Less than 1 EU/mg of rHuFGF-9 as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: FGF9 fibroblast growth factor 9 (glia-activating factor) [ Homo sapiens ]
• Official Symbol: FGF9
• Synonyms: FGF9; fibroblast growth factor 9 (glia-activating factor); fibroblast growth factor 9; FGF-9; HBGF-9; heparin-binding growth factor 9; GAF; SYNS3; HBFG-9; MGC119914; MGC119915
• Gene ID: 2254
• mRNA Refseq: NM_002010
• Protein Refseq: NP_002001
• MIM: 600921
• UniProt ID: P31371