Active Recombinant Human FGF7 Protein

• Cat.No.: FGF7-638H
• Product Overview: Recombinant Human FGF7 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Human KGF-1 also known as Fibroblast growth factor 7 (FGF-7), is encoded by the FGF7 gene. KGF-1 only binds to the b splice form of the tyrosine kinase receptor, FGFR2b KGFR. Affinity between KGF-1 and its receptor can be increased by heparin or heparan sulfate proteoglycan. FGF-10, also called keratinocyte growth factor 2 (KGF-2), shares 51 % amino acid sequence identity and similar function to KGF-1, but uses an additional receptor, FGFR2c. KGF-1 plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. KGF-1 actives on keratinocytes, and exhibits mitogenic activity for epidermal cells, but essentially no activity for fibroblasts. KGF-1 has species crossactive, human KGF-1 shares 96 % amino acid sequence identity with murine, and 92 % with rat.
• Form: Sterile Filtered White lyophil
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 10 ng/mL, corresponding to a specific activity of > 1.0×10^5 IU/mg.
• Molecular Mass: Approximately 18.9 kDa
• AA Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
• Endotoxin: Less than 1 EU/μg of rHuKGF-1/FGF-7 as determined by LAL method.
• Purity: > 96% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles.
• Storage Buffer: Lyophilized from a 0.2 μm filtered solution in 20 mM PB, 0.5 M NaCl, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

Gene Information

• Gene Name: FGF7 fibroblast growth factor 7 [ Homo sapiens (human) ]
• Official Symbol: FGF7
• Synonyms: FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7
• Gene ID: 2252
• mRNA Refseq: NM_002009
• Protein Refseq: NP_00200
• MIM: 148180
• UniProt ID: P21781