Active Recombinant Human FGF7 Protein (164 aa)
Cat.No. : | FGF7-087F |
Product Overview : | Recombinant Human FGF7 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 164 |
Description : | Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30 - 50% sequence identity at the amino acid level. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of variety of tissues, by promoting cellular proliferation and differentiation. KGF-1/FG-7 is a mitogen factor specific for epithelial cells and keratinocytes and signals through FGFR 2b. KGF-1/FGF-7 plays a role in kidney and lung development, angiogenesis, and wound healing. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 < 10 ng/mL,corresponding to a specific activity of ≥ 1 × 10^5 units/mg. |
Molecular Mass : | Approximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids. |
AA Sequence : | MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
Endotoxin : | Less than 1 EU/mg of rHuKGF-1 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered solution in 20mM PB, pH 8.0, 1M NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FGF7 fibroblast growth factor 7 [ Homo sapiens ] |
Official Symbol | FGF7 |
Synonyms | FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7; |
Gene ID | 2252 |
mRNA Refseq | NM_002009 |
Protein Refseq | NP_002000 |
MIM | 148180 |
UniProt ID | P21781 |
◆ Recombinant Proteins | ||
FGF7-3020H | Recombinant Human FGF7 Protein (Thr23-Thr216), C-His tagged | +Inquiry |
FGF7-1763H | Recombinant Human FGF7 protein, For Organoid Culture | +Inquiry |
FGF7-638H | Active Recombinant Human FGF7 Protein | +Inquiry |
FGF7-1523R | Recombinant Rhesus Macaque FGF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF7-410H | Active Recombinant Human FGF7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF7 Products
Required fields are marked with *
My Review for All FGF7 Products
Required fields are marked with *
0
Inquiry Basket