Active Recombinant Human FGF21 Protein, His-tagged

• Cat.No.: FGF21-287F
• Product Overview: Recombinant Human FGF21 Protein with a His tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Tag: His
• Description: FGF-21, also known as fibroblast growth factor-21 and FGFL, is a secreted growth factor belonging to theheparin-binding growth factor family. It is produced by hepatocytes in response to fatty acid stimulation. FGF-21 couples with its co-factor beta-Klotho to signal through FGFR1c and FGFR4. Signal transduction results in insulin-independent uptake of glucose by adipocytes. Clinical administration of FGF-21 induces energy expenditure, fat utilization and lipid excretion.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 0.3 μg/mL, measured in a bioassay using NIH-3T3 cells.
• Molecular Mass: 23-25kDa, observed by reducing SDS-PAGE.
• AA Sequence: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYASHHHHHH
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant human FGF-21 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human FGF-21, His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: FGF21 fibroblast growth factor 21 [ Homo sapiens ]
• Official Symbol: FGF21
• Synonyms: FGF21; fibroblast growth factor 21; FGF-21
• Gene ID: 26291
• mRNA Refseq: NM_019113
• Protein Refseq: NP_061986
• MIM: 609436
• UniProt ID: Q9NSA1