Active Recombinant Human FGF21 Protein, His-tagged
Cat.No. : | FGF21-287F |
Product Overview : | Recombinant Human FGF21 Protein with a His tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | His |
Description : | FGF-21, also known as fibroblast growth factor-21 and FGFL, is a secreted growth factor belonging to theheparin-binding growth factor family. It is produced by hepatocytes in response to fatty acid stimulation. FGF-21 couples with its co-factor beta-Klotho to signal through FGFR1c and FGFR4. Signal transduction results in insulin-independent uptake of glucose by adipocytes. Clinical administration of FGF-21 induces energy expenditure, fat utilization and lipid excretion. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 0.3 μg/mL, measured in a bioassay using NIH-3T3 cells. |
Molecular Mass : | 23-25kDa, observed by reducing SDS-PAGE. |
AA Sequence : | HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYASHHHHHH |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant human FGF-21 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human FGF-21, His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | FGF21 fibroblast growth factor 21 [ Homo sapiens ] |
Official Symbol | FGF21 |
Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
Gene ID | 26291 |
mRNA Refseq | NM_019113 |
Protein Refseq | NP_061986 |
MIM | 609436 |
UniProt ID | Q9NSA1 |
◆ Recombinant Proteins | ||
FGF21-3279H | Recombinant Human FGF21 protein, His-tagged | +Inquiry |
FGF21-28829TH | Recombinant Human FGF21, Fc-tagged | +Inquiry |
FGF21-104H | Recombinant Human FGF21, His-tagged | +Inquiry |
FGF21-28827TH | Recombinant Human FGF21, His-tagged | +Inquiry |
FGF21-28828TH | Recombinant Human FGF21, FLAG-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF21 Products
Required fields are marked with *
My Review for All FGF21 Products
Required fields are marked with *
0
Inquiry Basket