Recombinant Full Length Human FGF18 Protein, GST-tagged
Cat.No. : | FGF18-4817HF |
Product Overview : | Human FGF18 full-length ORF ( AAH06245, 29 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 207 amino acids |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. It has been shown in vitro that this protein is able to induce neurite outgrowth in PC12 cells. Studies of the similar proteins in mouse and chick suggested that this protein is a pleiotropic growth factor that stimulates proliferation in a number of tissues, most notably the liver and small intestine. Knockout studies of the similar gene in mice implied the role of this protein in regulating proliferation and differentiation of midline cerebellar structures. [provided by RefSeq |
Molecular Mass : | 45.43 kDa |
AA Sequence : | ENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSRRIRPTHPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGF18 fibroblast growth factor 18 [ Homo sapiens ] |
Official Symbol | FGF18 |
Synonyms | FGF18; fibroblast growth factor 18; FGF 18; ZFGF5; FGF-18; |
Gene ID | 8817 |
mRNA Refseq | NM_003862 |
Protein Refseq | NP_003853 |
MIM | 603726 |
UniProt ID | O76093 |
◆ Recombinant Proteins | ||
FGF18-224H | Active Recombinant Human Fibroblast Growth Factor 18, HIgG1 Fc-tagged | +Inquiry |
FGF18-12867H | Recombinant Human FGF18, GST-tagged | +Inquiry |
FGF18-4108H | Recombinant Human FGF18 Protein, GST-tagged | +Inquiry |
Fgf18-185R | Recombinant Rat Fgf18 protein, His/S-tagged | +Inquiry |
FGF18-522H | Active Recombinant Human FGF18 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF18-2430MCL | Recombinant Mouse FGF18 cell lysate | +Inquiry |
FGF18-1660HCL | Recombinant Human FGF18 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF18 Products
Required fields are marked with *
My Review for All FGF18 Products
Required fields are marked with *
0
Inquiry Basket