Active Recombinant Human FGF-8f Protein (223 aa)

• Cat.No.: FGF-8f-407F
• Product Overview: Recombinant human Fibroblast Growth Factor 8f (rhFGF-8f) produced in E. coli is a single non-glycosylated polypeptide chain containing 223 amino acids. A fully biologically active molecule, rhFGF-8f has a molecular mass of 25.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• ProteinLength: 223
• Description: Fibroblast Growth Factor 8f (FGF-8f) is a cytokine belonging to the heparin-binding FGF family, which has at least 23 members. FGF-8 has 8 different isoforms, named FGF-8a through FGF-8h. Different FGF-8 isoforms have different receptor affinities, and thus participate in different signaling cascade pathways. FGF-8 has widespread expression during embryonic development, promoting gastrulation, somitogenesis, morphogenesis, and limb formation. FGF-8 also has oncogenic potential. While in normal cells FGF-8 is expressed at very low levels, in breast, prostate and ovarian cancer FGF-8 is highly expressed.FGF-8 promotes tumor angiogenesis by increasing neovascularization, and inducing osteoblastic differentiation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 50 ng/mL, measured by a cell proliferation assayusing 3T3 cellsin the presence of 10 μg/mL of heparin, corresponding to a specific activity of > 2 × 10^4 units/mg.
• Molecular Mass: 25.5 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE analysis.
• Storage: Lyophilized recombinant human Fibroblast Growth Factor 8f(rhFGF-8f) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-8f remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Official Symbol: FGF-8f
• Synonyms: Fibroblast Growth Factor 8f; FGF-8f