Active Recombinant Human FGF-8e Protein (212 aa)

• Cat.No.: FGF-8e-408F
• Product Overview: Recombinant Human FGF-8e produced in E. coli is a single non-glycosylated polypeptide chain containing 212 amino acids. A fully biologically active molecule, rhFGF-8e has a molecular mass of 24.3 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• ProteinLength: 212
• Description: Fibroblast Growth Factor 8e (FGF-8e) is a cytokine belonging to the heparin-binding FGF family, which has at least 23 members. FGF-8 has 8 different isoforms, named FGF-8a through FGF-8h. Different FGF-8 isoforms have different receptor affinities, and thus participate in different signaling cascade pathways. FGF-8 has widespread expression during embryonic development, promoting gastrulation, somitogenesis, morphogenesis, and limb formation. FGF-8 also has oncogenic potential. While in normal cells FGF-8 is expressed at very low levels, in breast, prostate and ovarian cancer FGF-8 is highly expressed.FGF-8 promotes tumor angiogenesis by increasing neovascularization, and inducing osteoblastic differentiation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 2.5 μg/mL in the presence of 1 μg/mL heparin, measured in a cell proliferation assay using 3T3.
• Molecular Mass: 24.3 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE
• Storage: Lyophilized recombinant Human FGF 8e remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human FGF 8e should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Official Symbol: FGF-8e
• Synonyms: Fibroblast Growth Factor 8e; FGF-8e