Active Recombinant Human ERBB4, Fc-tagged, Biotinylated

• Cat.No.: ERBB4-623H
• Product Overview: The recombinant human HER4 extracellular or ecto-domain (ECD) is expressed as a 862 amino acid protein consisting of Gln26-Pro651 region of HER4 and a C-terminal Fc from human IgG1, which exists as a dimmerr under non-reducing conditions.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 26-651 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: It was reported to inhibit the biological activity of Neuregulin-1 on MCF?7 human breast cancer cells
• Molecular Mass: Calculated molecular mass (kDa): 96.3; Estimated by SDS-PAGE under reducing condition (kDa): 100
• AA Sequence: QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPL ENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPS NLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCF ACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIK MCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTV REITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYY HTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEF REFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPC HPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPSTGDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSN KALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: ERBB4 v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) [ Homo sapiens ]
• Official Symbol: ERBB4
• Synonyms: ERBB4; v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian); v erb a avian erythroblastic leukemia viral oncogene homolog like 4; receptor tyrosine-protein kinase erbB-4; proto-oncogene-like protein c-ErbB-4; tyrosine kinase-type cell surface receptor HER4; avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4; HER4; p180erbB4; MGC138404
• Gene ID: 2066
• mRNA Refseq: NM_001042599
• Protein Refseq: NP_001036064
• MIM: 600543
• UniProt ID: Q15303
• Chromosome Location: 2q33.3-q34
• Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Downregulation of ERBB4 signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; ErbB signaling pathway, organism-specific biosystem; ErbB signaling pathway, organism-specific biosystem
• Function: ATP binding; epidermal growth factor receptor binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity; receptor signaling protein tyrosine kinase activity; transcription regulatory region DNA binding; transmembrane receptor protein tyrosine kinase activity