Active Recombinant Human EPGN protein

• Cat.No.: EPGN-014H
• Product Overview: Recombinant Human EPGN was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Bio-activity: Determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells. The expected ED50 for this effect is 150-300 ng/ml.
• Molecular Mass: 7.9 kDa
• AA Sequence: AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: EPGN epithelial mitogen [ Homo sapiens (human) ]
• Official Symbol: EPGN
• Synonyms: EPG; PRO9904; ALGV3072; EPGN
• Gene ID: 255324
• mRNA Refseq: NM_001013442
• Protein Refseq: NP_001013460
• UniProt ID: Q6UW88