Active Recombinant Human DEFB1 Protein (47 aa)
Cat.No. : | DEFB1-134D |
Product Overview : | Recombinant Human DEFB1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 47 |
Description : | Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The α-defensins are distinguished from the β-defensins by the pairing of their three disulfide bonds. To date, four human β-defensins have been identified; BD-1, BD-2, BD-3 and BD-4. β-defensins are expressed on some leukocytes and at epithelial surfaces. In addition to their direct antimicrobial activities, they are chemoattractant towards immature dendritic cells and memory T cells. The β-defensin proteins are expressed as the C-terminal portion of precursors and are released by proteolytic cleavage of a signal sequence and, in the case of BD-1 (36 a.a.), a propeptide region. β-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. β-Defensins are 3-5 kDa peptides ranging in size from 33-47 amino acid residues. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract CD34+ dendritic cells using a concentration range of 0.1-1.0 μg/mL, corresponding to a Specific Activity of >1000 IU/mg. |
Molecular Mass : | Approximately 5.0 KDa, a single non-glycosylated polypeptide chain containing 47 amino acids. |
AA Sequence : | GNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK |
Endotoxin : | Less than 1 EU/μg of rHuBD-1 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | DEFB1 defensin, beta 1 [ Homo sapiens ] |
Official Symbol | DEFB1 |
Synonyms | DEFB1; defensin, beta 1; beta-defensin 1; BD1; DEFB 1; DEFB101; HBD 1; HBD1; MGC51822; BD-1; beta-defensin-1; DEFB-1; |
Gene ID | 1672 |
mRNA Refseq | NM_005218 |
Protein Refseq | NP_005209 |
MIM | 602056 |
UniProt ID | P60022 |
◆ Recombinant Proteins | ||
DEFB1-1052R | Recombinant Rhesus Macaque DEFB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DEFB1-17H | Active Recombinant Human DEFB1 protein(1-47aa) | +Inquiry |
Defb1-596R | Recombinant Rat Defb1 protein | +Inquiry |
Defb1-2814M | Recombinant Mouse Defb1 protein, His-SUMO-tagged | +Inquiry |
Defb1-6877M | Recombinant Mouse Defb1 protein, His & S-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB1-6989HCL | Recombinant Human DEFB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DEFB1 Products
Required fields are marked with *
My Review for All DEFB1 Products
Required fields are marked with *
0
Inquiry Basket