Recombinant Mouse Defb1 protein, His-SUMO-tagged
Cat.No. : | Defb1-2814M |
Product Overview : | Recombinant Mouse Defb1 protein(P56386)(33-69aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 33-69aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.1 kDa |
AA Sequence : | DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Defb1 defensin beta 1 [ Mus musculus ] |
Official Symbol | Defb1 |
Synonyms | DEFB1; defensin beta 1; beta-defensin 1; BD-1; AW260221; |
Gene ID | 13214 |
mRNA Refseq | NM_007843 |
Protein Refseq | NP_031869 |
◆ Recombinant Proteins | ||
DEFB1-1829R | Recombinant Rat DEFB1 Protein | +Inquiry |
DEFB1-1946H | Recombinant Human DEFB1 Protein (Gly22-Lys68), N-GST tagged | +Inquiry |
DEFB1-198H | Recombinant Human DEFB1 protein | +Inquiry |
Defb1-6877M | Recombinant Mouse Defb1 protein, His & S-tagged | +Inquiry |
Defb1-568M | Recombinant Mouse Defb1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DEFB1-6989HCL | Recombinant Human DEFB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Defb1 Products
Required fields are marked with *
My Review for All Defb1 Products
Required fields are marked with *
0
Inquiry Basket