Active Recombinant Human CSF2 Protein

• Cat.No.: CSF2-155C
• Product Overview: Recombinant Human Granulocyte Macrophage Colony Stimulating Factor (rhGM-CSF) produced in P. pastoris a glycosylated polypeptide. A fully biologically active molecule, rhGM-CSF has a molecular mass of 26-32 kDa analyzed by SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques.

Specification

• Species: Human
• Source: P.pastoris
• Description: Human Granulocyte Macrophage Colony Stimulating Factor (hGM-CSF), a hematopoietic growth factor, is mainly involved in granulopoiesis and monocytopoiesis. It is produced by T-cells and macrophages in response to antigens, and by endothelial cells and fibroblasts following induction of variouscytokines. A monomeric protein of 127 amino acidswith six glycosylation sites and two intra disulfide bonds, glycosylated and non-glycosylated hGM-CSFs show similar biological activities. Other than its connection to the growth and development of granulocytes and macrophages, it is also indispensable for the proliferation of erythroid and megakaryocytic cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 0.2 ng/mL, measured by proliferation assay of TF-1 cells, corresponding to a specific activity of > 56 units/mg.
• Molecular Mass: 26-32kDa, observed by SDS-PAGE.
• AA Sequence: MAPARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Purity: > 95 % as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant human Granulocyte Macrophage Colony Stimulating Factor (rhGM-CSF) remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rhGM-CSF should be stable up to 4 weeks at 4 centigrade or up to 6 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 10 mM PB, pH7.0.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens ]
• Official Symbol: CSF2
• Synonyms: CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897
• Gene ID: 1437
• mRNA Refseq: NM_000758
• Protein Refseq: NP_000749
• MIM: 138960
• UniProt ID: P04141