Active Recombinant Human CD84, Fc-tagged, Biotinylated

• Cat.No.: CD84-685H
• Product Overview: The recombinant human SLAMF5-Fc fusion protein is expressed as a 431-amino acid protein consisting of Lys22 - Gly225 region of SLAMF5 (UniProt accession #Q9UIB8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Immobilized SLAMF5 interacts homophilically with SLAMF5 in a functional ELISA and enhances the proliferation of PHA-stimulated T cells in the presence of anti--CD3e antibody
• Molecular Mass: Calculated molecular mass (kDa): 48.2; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
• AA Sequence: KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVI SDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSP LGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGSTGTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 22-225 a.a.

Gene Information

• Gene Name: CD84 CD84 molecule [ Homo sapiens ]
• Official Symbol: CD84
• Synonyms: CD84; CD84 molecule; CD84 antigen (leukocyte antigen) , CD84 molecule; SLAM family member 5; hCD84; mCD84; SLAMF5; hly9-beta; leukocyte antigen CD84; cell surface antigen MAX.3; CD84 antigen (leukocyte antigen); leucocyte differentiation antigen CD84; leukocyte differentiation antigen CD84; signaling lymphocytic activation molecule 5; LY9B; DKFZp781E2378
• Gene ID: 8832
• mRNA Refseq: NM_001184879
• Protein Refseq: NP_001171808
• MIM: 604513
• UniProt ID: Q9UIB8
• Chromosome Location: 1q24
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem
• Function: receptor activity