Active Recombinant Human CD84, Fc-tagged
Cat.No. : | CD84-686H |
Product Overview : | The recombinant human SLAMF5-Fc fusion protein is expressed as a 431-amino acid protein consisting of Lys22 - Gly225 region of SLAMF5 (UniProt accession #Q9UIB8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 22-225 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
Bio-activity : | Immobilized SLAMF5 interacts homophilically with SLAMF5 in a functional ELISA and enhances the proliferation of PHA-stimulated T cells in the presence of anti--CD3e antibody |
Molecular Mass : | Calculated molecular mass (kDa): 48.2; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 |
AA Sequence : | KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVI SDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSP LGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGSTGTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CD84 CD84 molecule [ Homo sapiens ] |
Official Symbol | CD84 |
Synonyms | CD84; CD84 molecule; CD84 antigen (leukocyte antigen) , CD84 molecule; SLAM family member 5; hCD84; mCD84; SLAMF5; hly9-beta; leukocyte antigen CD84; cell surface antigen MAX.3; CD84 antigen (leukocyte antigen); leucocyte differentiation antigen CD84; leukocyte differentiation antigen CD84; signaling lymphocytic activation molecule 5; LY9B; DKFZp781E2378; |
Gene ID | 8832 |
mRNA Refseq | NM_001184879 |
Protein Refseq | NP_001171808 |
MIM | 604513 |
UniProt ID | Q9UIB8 |
Chromosome Location | 1q24 |
Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
Function | receptor activity; |
◆ Recombinant Proteins | ||
CD84-5258H | Recombinant Human CD84 Protein (Lys22-Gly225), C-His tagged | +Inquiry |
CD84-729H | Recombinant Human CD84 Protein (Lys22-Gly225), C-mFc and 6×His-tagged | +Inquiry |
CD84-152H | Recombinant Human CD84 Protein, His-tagged | +Inquiry |
CD84-3082HF | Recombinant Full Length Human CD84 Protein | +Inquiry |
Cd84-6900M | Active Recombinant Mouse Cd84 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD84-1129CCL | Recombinant Cynomolgus CD84 cell lysate | +Inquiry |
CD84-1733MCL | Recombinant Mouse CD84 cell lysate | +Inquiry |
CD84-3041HCL | Recombinant Human CD84 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD84 Products
Required fields are marked with *
My Review for All CD84 Products
Required fields are marked with *
0
Inquiry Basket