Active Recombinant Human CD48, Fc-tagged, Biotinylated

• Cat.No.: CD48-680H
• Product Overview: The recombinant human SLAMF2-Fc fusion protein is expressed as a 421-amino acid protein consisting of Gln27 - Arg219 region of SLAMF2 (UniProt accession #P09326) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Immobilized SLAMF2 interacts heterophilically with CD2 and SLAMF4/CD244/2B4.
• Molecular Mass: Calculated molecular mass (kDa): 47.8; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
• AA Sequence: QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQK EDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKE LQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSTGTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 27-219 a.a.

Gene Information

• Gene Name: CD48 CD48 molecule [ Homo sapiens ]
• Official Symbol: CD48
• Synonyms: CD48; CD48 molecule; BCM1, CD48 antigen (B cell membrane protein) , CD48 molecule; CD48 antigen; BLAST; hCD48; mCD48; SLAMF2; TCT.1; BCM1 surface antigen; leukocyte antigen MEM-102; B-lymphocyte activation marker BLAST-1; CD48 antigen (B-cell membrane protein); BCM1; BLAST1; MEM-102
• Gene ID: 962
• mRNA Refseq: NM_001256030
• Protein Refseq: NP_001242959
• MIM: 109530
• UniProt ID: P09326
• Chromosome Location: 1q21.3-q22
• Pathway: Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem
• Function: antigen binding; eukaryotic cell surface binding; protein binding; receptor activity