Active Recombinant Human CD47 Protein, His-tagged

Cat.No. : CD47-08H
Product Overview : Recombinant human CD47 (19-141 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 129
Description : This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human SIRP gamma/CD172g.
Molecular Mass : 14.7 kDa
AA Sequence : QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name CD47 CD47 molecule [ Homo sapiens (human) ]
Official Symbol CD47
Synonyms CD47; CD47 molecule; IAP; OA3; MER6; leukocyte surface antigen CD47; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); CD47 glycoprotein; Rh-related antigen; antigen identified by monoclonal antibody 1D8; antigenic surface determinant protein OA3; integrin associated protein; integrin-associated signal transducer
Gene ID 961
mRNA Refseq NM_001777
Protein Refseq NP_001768
MIM 601028
UniProt ID Q08722

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All C Products

Required fields are marked with *

My Review for All C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon