Active Recombinant Human CD38, Fc-tagged

• Cat.No.: CD38-574H
• Product Overview: The recombinant human CD38-Fc is expressed as a 482-amino acid protein consisting of Arg47 - Ile300 region of CD38 (UniProt accession #P28907) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
• Bio-activity: Immobilized CD38 binds anti-CD38 monoclonal antibodies, human IgG1, mouse IgG2a and rabbit IgG in a functional ELISA. Converts the enzymatic substrate nicotinamide guanine dinucleotide (NGD+) to cyclic GDP-ribose.
• Molecular Mass: Calculated molecular mass (kDa): 54.9; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
• AA Sequence: RQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSR RFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISK RNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEISTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 47-300 a.a.
• Publications:
  Challenges in αCD38-chimeric antigen receptor (CAR)-expressing natural killer (NK) cell-based immunotherapy in multiple myeloma: Harnessing the CD38dim phenotype of cytokine-stimulated NK cells as a strategy to prevent fratricide (2023)

Gene Information

• Gene Name: CD38 CD38 molecule [ Homo sapiens ]
• Official Symbol: CD38
• Synonyms: CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase; cADPr hydrolase 1; cyclic ADP-ribose hydrolase 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase; T10
• Gene ID: 952
• mRNA Refseq: NM_001775
• Protein Refseq: NP_001766
• MIM: 107270
• UniProt ID: P28907
• Chromosome Location: 4p15.32
• Pathway: Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Metabolic pathways, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem
• Function: NAD+ nucleosidase activity; hydrolase activity, acting on glycosyl bonds; nucleotide binding; phosphorus-oxygen lyase activity; receptor activity