Active Recombinant Human CD38 Protein, Fc-tagged, Alexa Fluor 488 conjugated

• Cat.No.: CD38-574HAF488
• Product Overview: The Alexa Fluor 488 conjugated recombinant human CD38-Fc is expressed as a 482-amino acid protein consisting of Arg47 - Ile300 region of CD38 (UniProt accession #P28907) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: HEK293
• Species: Human
• Tag: Fc
• Bio-activity: Immobilized CD38 binds anti-CD38 monoclonal antibodies, human IgG1, mouse IgG2a and rabbit IgG in a functional ELISA. Converts the enzymatic substrate nicotinamide guanine dinucleotide (NGD+) to cyclic GDP-ribose.
• Molecular Mass: Calculated molecular mass (kDa): 54.9; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
• AA Sequence: RQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQTVPCN KILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSR RFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDLCQDPTIKELESIISK RNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEISTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: < 0.1 EU/ μg of purified recombinant protein determined by the LAL method
• Purity: > 95 % by SDS-PAGE under reducing condition
• Characteristic: Disulfide-linked homodimer
  Labeled with Alexa Fluor 488 via amines
  Excitation Wavelength: 488 nm
  Emission Wavelength: 515­-545 nm
• Storage: The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Supplied at 0.5 mg/ml in sterile PBS pH 7.4 (carrier & preservative free).
• Protein length: 47-300 a.a.

Gene Information

• Gene Name: CD38 CD38 molecule [ Homo sapiens ]
• Official Symbol: CD38
• Synonyms: CD38; CD38 molecule; CD38 antigen (p45); ADP-ribosyl cyclase 1; ADP ribosyl cyclase 1; NAD(+) nucleosidase; cADPr hydrolase 1; cyclic ADP-ribose hydrolase 1; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase; T10
• Gene ID: 952
• mRNA Refseq: NM_001775
• Protein Refseq: NP_001766
• MIM: 107270
• UniProt ID: P28907