Active Recombinant Human CD34, His-tagged, Biotinylated

• Cat.No.: CD34-572H
• Product Overview: The recombinant human CD34 ECD protein is expressed as a 280-amino acid protein consisting of Ser32 - Thr290 region of (UniProt accession #P28906) and a C-terminal His-tag. It contains 9 potential N-linked glycosylation sites.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• ProteinLength: 32-290 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Interacts with L-selectin and supports the adhesion of the human umbilical vein endothelial cell line (HUVEC). Binds anti-CD34 monoclonal antibodies, human IgG1 and rabbit IgG by ELISA with this immobilized protein.
• Molecular Mass: Calculated molecular mass (kDa): 30; Estimated by SDS-PAGE under reducing condition (kDa): 75-90 suggesting that the protein may be heavily glycosylated.
• AA Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNT NSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEIS SKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTSTTENLYFQGSTGHHHHHHHH
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >92% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: CD34 CD34 molecule [ Homo sapiens ]
• Official Symbol: CD34
• Synonyms: CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34
• Gene ID: 947
• mRNA Refseq: NM_001025109
• Protein Refseq: NP_001020280
• MIM: 142230
• UniProt ID: P28906
• Chromosome Location: 1q32
• Pathway: Adaptive Immune System, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Immune System, organism-specific biosystem
• Function: carbohydrate binding; sulfate binding; transcription factor binding