Active Recombinant Human CD22, His-tagged, Biotinylated

Cat.No. : CD22-559H
Product Overview : The recombinant human CD22 ECD is expressed as a 675 amino acid protein consisting of Asp20 - Thr683 region of CD22 (UniProt accession #P20273) and a C-terminal His-tag. It contains 12 potential sites for N-linked glycosylation.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : 20-683 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized CD22 ECD protein supports the adhesion of human red blood cells. Binds anti-CD22 monoclonal antibodies with high affinity (KD< 5="" nm)="" by="">
Molecular Mass : Calculated molecular mass (kDa): 76.0; Estimated by SDS-PAGE under reducing condition (kDa): 100-110 probably due to glycosylation.
AA Sequence : DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQF LGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCY GYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTP KLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVG PGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWH AGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEE PSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE VQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSA TLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETSTG HHHHHHHH
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >90% judged by SDS-PAGE under reducing condition.
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name CD22 CD22 molecule [ Homo sapiens ]
Official Symbol CD22
Synonyms CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020;
Gene ID 933
mRNA Refseq NM_001185099
Protein Refseq NP_001172028
MIM 107266
UniProt ID P20273
Chromosome Location 19q13.1
Pathway B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem;
Function protein binding; sugar binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CD22 Products

Required fields are marked with *

My Review for All CD22 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon