Active Recombinant Human CD22, His-tagged, Biotinylated

• Cat.No.: CD22-559H
• Product Overview: The recombinant human CD22 ECD is expressed as a 675 amino acid protein consisting of Asp20 - Thr683 region of CD22 (UniProt accession #P20273) and a C-terminal His-tag. It contains 12 potential sites for N-linked glycosylation.

Specification

• Species: Human
• Source: Human Cells
• Tag: His
• Protein Length: 20-683 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Immobilized CD22 ECD protein supports the adhesion of human red blood cells. Binds anti-CD22 monoclonal antibodies with high affinity (KD< 5="" nm)="" by="">
• Molecular Mass: Calculated molecular mass (kDa): 76.0; Estimated by SDS-PAGE under reducing condition (kDa): 100-110 probably due to glycosylation.
• AA Sequence: DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQF LGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCY GYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTP KLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVG PGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWH AGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEE PSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE VQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSA TLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETSTG HHHHHHHH
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >90% judged by SDS-PAGE under reducing condition.
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: CD22 CD22 molecule [ Homo sapiens ]
• Official Symbol: CD22
• Synonyms: CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020
• Gene ID: 933
• mRNA Refseq: NM_001185099
• Protein Refseq: NP_001172028
• MIM: 107266
• UniProt ID: P20273
• Chromosome Location: 19q13.1
• Pathway: B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem; BCR signaling pathway, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem
• Function: protein binding; sugar binding