Active Recombinant Human CD200 Protein, His-tagged

• Cat.No.: CD200-06H
• Product Overview: Recombinant human CD200 protein (31-232 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Description: This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Source: Insect Cell
• Species: Human
• Tag: His
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Human CD200R1.
• Molecular Mass: 23.5 kDa
• Protein length: 211
• AA Sequence: QVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKG
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: CD200 CD200 molecule [ Homo sapiens (human) ]
• Official Symbol: CD200
• Synonyms: CD200; CD200 molecule; MRC; MOX1; MOX2; OX-2; OX-2 membrane glycoprotein; CD200 antigen; antigen identified by monoclonal antibody MRC OX-2
• Gene ID: 4345
• mRNA Refseq: NM_005944
• Protein Refseq: NP_005935
• MIM: 155970
• UniProt ID: P41217