Active Recombinant Human CCL3 Protein

• Cat.No.: CCL3-0636H
• Product Overview: Human CCL3 (P10147, 24 a.a. - 92 a.a.) partial recombinant protein expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 24-92 a.a.
• Description: This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.[provided by RefSeq, Sep 2010]
• Form: Lyophlized
• Bio-activity: Determined by its ability to chemoattract human monocytes using a concentration range of 1.0-10.0 ng/mL.
• Molecular Mass: 8 kDa
• AA Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
• Endotoxin: < 0.1 ng/μg (1 EU/μg)
• Purity: > 90% by SDS-PAGE and HPLC
• Applications: Functional Study
  SDS-PAGE
• Storage: Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophlized from PBS, pH 7.5

Gene Information

• Gene Name: CCL3 chemokine (C-C motif) ligand 3 [ Homo sapiens ]
• Official Symbol: CCL3
• Synonyms: CCL3; chemokine (C-C motif) ligand 3; SCYA3, small inducible cytokine A3 (homologous to mouse Mip 1a); C-C motif chemokine 3; G0S19 1; LD78ALPHA; MIP 1 alpha; SIS-beta; PAT 464.1; G0/G1 switch regulatory protein 19-1; macrophage inflammatory protein 1-alpha; tonsillar lymphocyte LD78 alpha protein; small inducible cytokine A3 (homologous to mouse Mip-1a); MIP1A; SCYA3; G0S19-1; MIP-1-alpha
• Gene ID: 6348
• mRNA Refseq: NM_002983
• Protein Refseq: NP_002974
• MIM: 182283
• UniProt ID: P10147