Active Recombinant Mouse Ccl3 Protein

• Cat.No.: Ccl3-132M
• Product Overview: Purified recombinant protein of Mouse chemokine (C-C motif) ligand 3 (Ccl3) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Monokine with inflammatory, pyrogenic and chemokinetic properties. Has a potent chemotactic activity for eosinophils. Binding to a high-affinity receptor activates calcium release in neutrophils.
• Bio-activity: Determined by its ability to chemoattract murine balb/c splenocytes using a concentration range of 10.0-100.0 ng/ml.
• Molecular Mass: 7.8 kDa
• AA Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Ccl3 chemokine (C-C motif) ligand 3 [ Mus musculus (house mouse) ]
• Official Symbol: Ccl3
• Synonyms: Ccl3; chemokine (C-C motif) ligand 3; Mip1a; Scya3; G0S19-1; AI323804; MIP1-(a); LD78alpha; MIP-1alpha; MIP1-alpha; C-C motif chemokine 3; L2G25B; MIP-1-alpha; MIP1 (a); SIS-alpha; TY-5; heparin-binding chemotaxis protein; macrophage inflammatory protein 1-alpha; macrophage inflammatory protein-1alpha; small-inducible cytokine A3
• Gene ID: 20302
• mRNA Refseq: NM_011337
• Protein Refseq: NP_035467
• UniProt ID: P10855