Active Recombinant Human CCL16 Protein (97 aa)

• Cat.No.: CCL16-113C
• Product Overview: Recombinant Human CCL16 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 97
• Description: Human HCC-4, also named NCC-4, liver-expressed chemokine (LEC), and lymphocyte and monocyte chemoattractant (LMC), is a novel CC chemokine identified through bioinformatics. HCC-4 cDNA encodes a 120 amino acid (aa) residue precursor protein with a 23 aa residue predicted signal peptide that is cleaved to generate a 97 aa residue mature protein. HCC-4 is distantly related to other CC chemokines, exhibiting less than 30% sequence identity. Among these CC chemokines, HCC-4 has the most similarity to HCC-1. Two potential polyadenylation signals are present on the human HCC-4 gene, and as a result, two transcripts containing approximately 1,500 base pairs and 500 base pairs have been detected. HCC-4 is expressed weakly by some lymphocytes, including NK cells, T cells, and some T cell clones. The expression of HCC-4 in monocytes is highly upregulated in the presence of IL-10.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract total human monocytes using a concentration range of 10.0 -100.0 ng/mL, corresponding to a Specific Activity of ＞1 × 10^4 IU/mg.
• Molecular Mass: 11.2 kDa, a single non-glycosylated polypeptide chain containing 97 amino acids.
• AA Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
• Endotoxin: Less than 1 EU/mg of rHuHCC-4/CCL16 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: CCL16 chemokine (C-C motif) ligand 16 [ Homo sapiens ]
• Official Symbol: CCL16
• Synonyms: CCL16; chemokine (C-C motif) ligand 16; SCYA16, small inducible cytokine subfamily A (Cys Cys), member 16; C-C motif chemokine 16; CKb12; HCC 4; LCC 1; LEC; LMC; Mtn 1; NCC 4; SCYL4; monotactin-1; chemokine LEC; chemokine CC-4; new CC chemokine 4; liver CC chemokine-1; IL-10-inducible chemokine; liver-expressed chemokine; small-inducible cytokine A16; lymphocyte and monocyte chemoattractant; small inducible cytokine subfamily A (Cys-Cys), member 16; NCC4; HCC-4; LCC-1; Mtn-1; NCC-4; ILINCK; SCYA16; MGC117051
• Gene ID: 6360
• mRNA Refseq: NM_004590
• Protein Refseq: NP_004581
• MIM: 601394
• UniProt ID: O15467